PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID e_gw1.05.00.32.1
Common NameOT_ostta05g00460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB
Protein Properties Length: 756aa    MW: 85111.3 Da    PI: 5.9283
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
e_gw1.05.00.32.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-14853248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      g W   Ede+l+ av ++G+++W+++++ ++ ++++kqck rw+ +l
  e_gw1.05.00.32.1  8 GVWKNTEDEILKAAVMKYGKNQWSRVSSLLN-RKSAKQCKARWYEWL 53
                      78*****************************.************986 PP

2Myb_DNA-binding33.68.9e-1160103248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  e_gw1.05.00.32.1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPVVG--RTPSQCLERYEKLL 103
                       68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.227257IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-18457IPR009057Homeodomain-like
SMARTSM007179.5E-15655IPR001005SANT/Myb domain
PfamPF139214.1E-141070No hitNo description
CDDcd001671.58E-111053No hitNo description
SuperFamilySSF466893.95E-2133106IPR009057Homeodomain-like
CDDcd116594.65E-3055106No hitNo description
Gene3DG3DSA:1.10.10.607.2E-1458104IPR009057Homeodomain-like
SMARTSM007178.0E-1358105IPR001005SANT/Myb domain
PROSITE profilePS5129416.28358107IPR017930Myb domain
PfamPF118312.6E-34399606IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MRIQIKGGVW KNTEDEILKA AVMKYGKNQW SRVSSLLNRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPVVGR TPSQCLERYE KLLDAACAKD EDYDAGDDPR  120
RLRPGEIDPN PETKPAKPDA VDMDEDEKEM LAEARARLAN TKGKKAKRKA REKQLEEARR  180
LAELQKKREL KAAGIAHVRK AKRVRGVDYN AEIAFERKPD AVMYDTREED EAFAKMQAAK  240
VFKPISLAEL EGKKSAKEMD EANKKLAEAR QKMQERRDMP GAVQQNLKAN DASFTRRSKL  300
LLPTPQVSDR ELEDIAKMGK GVSGLLDDGG TTPASALLSS YEQTPATSTA RTPMRTPMVE  360
GDAILREAQQ QAARRNQKST LFGGGEEAAA LMPTDFAGAT PSRTRATPTP SRSEVSSQMG  420
TTPLLHGQTP IRDGLHINDQ YAAHFTDLSE RERRAHAAST SASLKGAFMS LPKPQNEYQV  480
DLPEAEEMED ELMEDAIVED EADARARQAA ALAEYEAMQM RKRSRAVQLD LPRPTEMVVV  540
EPLAGDAMSK LVNDEATDLL AHDVAKYSKN TRPAVSIEEF DESLMTNARE LIEAEAQEML  600
REQNSSREDF ADAFIAALVE ERKKNIFVPS LNSNISVDEA TEEQRLEAAK ACFESLRRDM  660
EKDAKRASKL EQKCNLLTAG LQKRDGELRQ KLKKTVDEIQ SLAIEAESFA MLHEQEQRAA  720
PERIEYWLEL VQAARAREKL LQEKYSQLTR ELNAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-9532242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003079144.10.0CDC5 protein (ISS)
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A090M0R50.0A0A090M0R5_
STRINGQ019X30.0(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP10401617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.11e-175cell division cycle 5
Publications ? help Back to Top
  1. Derelle E, et al.
    Genome analysis of the smallest free-living eukaryote Ostreococcus tauri unveils many unique features.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(31): p. 11647-52
    [PMID:16868079]